SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000313061 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000313061
Domain Number 1 Region: 35-303
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.96e-89
Family Inorganic pyrophosphatase 0.000000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000313061   Gene: ENSG00000138777   Transcript: ENST00000348706
Sequence length 305
Comment pep:known chromosome:GRCh38:4:105369243:105474064:-1 gene:ENSG00000138777 transcript:ENST00000348706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKVNSKEENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQY
VKDGKLRYVANIFPYKGYIWNYGTLPQILSCGEVIHVKILGILALIDEGETDWKLIAINA
NDPEASKFHDIDDVKKFKPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIK
STHQCWKALLMKKCNGGAINCTNVQISDSPFRCTQEEARSLVESVSSSPNKESNEEEQVW
HFLGK
Download sequence
Identical sequences K7A542
ENSP00000313061 ENSP00000313061 NP_008834.3.87134 NP_008834.3.92137 XP_001170451.1.37143 XP_003830018.1.60992 gi|77812678|ref|NP_008834.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]