SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000313437 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000313437
Domain Number 1 Region: 282-472
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.36e-59
Family Hemopexin-like domain 0.00011
Further Details:      
 
Domain Number 2 Region: 81-255
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.59e-45
Family Matrix metalloproteases, catalytic domain 0.0000389
Further Details:      
 
Domain Number 3 Region: 29-89
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000188
Family MMP N-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000313437   Gene: ENSG00000123342   Transcript: ENST00000322569
Sequence length 508
Comment pep:known chromosome:GRCh38:12:55836426:55842922:-1 gene:ENSG00000123342 transcript:ENST00000322569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAF
QEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTL
PPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHA
DIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPH
FKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGP
RGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRY
INFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKG
LFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTT
PSGGNTTPSGTGITLDTTLSATETTFEY
Download sequence
Identical sequences Q99542
ENSP00000313437 NP_002420.1.87134 NP_002420.1.92137 ENSP00000313437 ENSP00000313437 9606.ENSP00000313437 gi|4505213|ref|NP_002420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]