SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000313877 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000313877
Domain Number 1 Region: 222-339
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 5.36e-24
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 99-228
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.44e-19
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000033
Further Details:      
 
Domain Number 3 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000222
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000313877   Gene: ENSG00000123297   Transcript: ENST00000323833
Sequence length 346
Comment pep:known chromosome:GRCh38:12:57782776:57796734:1 gene:ENSG00000123297 transcript:ENST00000323833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKVQWLTPVNLALWEAEAGGS
LEGFLNSSELSGLPAGPDREGSLKDQLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHG
AMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGRRLGQHVVGMAPLSVGSLDDEPGGEA
ETKMLSQPYLLDPSITLGQYVQPQGVSVVDFVRFECGEGEEAAETE
Download sequence
Identical sequences NP_001166167.1.87134 NP_001166167.1.92137 ENSP00000313877 gi|291084500|ref|NP_001166167.1| ENSP00000313877 ENSP00000313877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]