SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000314407 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000314407
Domain Number 1 Region: 28-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.03e-80
Family Carbonic anhydrase 0.00000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000314407   Gene: ENSG00000178538   Transcript: ENST00000317995
Sequence length 290
Comment pep:known chromosome:GRCh38:8:60187347:60281412:-1 gene:ENSG00000178538 transcript:ENST00000317995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREAR
YDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWG
RENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLK
AVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPL
TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
Download sequence
Identical sequences A0A096MSS8 A0A2K5HGS8 A0A2K5M8H4 A0A2K6A0H9 A0A2K6BB44 A0A2K6LEJ6 A0A2K6PKI2 F7HSA2 G1QN06 G7PBW7 H2QW78 I3MB31 P35219
ENSP00000314407 ENSMMUP00000008482 ENSP00000314407 NP_001248224.1.72884 NP_001308766.1.87134 NP_001308766.1.92137 NP_004047.3.87134 NP_004047.3.92137 XP_003256066.1.23891 XP_005323034.1.77405 XP_005563441.1.63531 XP_010358649.1.97406 XP_011740566.1.29376 XP_011787339.1.43180 XP_011837565.1.47321 XP_011947324.1.92194 XP_015341334.1.40921 XP_016814995.1.37143 XP_017743093.1.44346 XP_519778.2.37143 ENSPTRP00000034722 9544.ENSMMUP00000008482 9598.ENSPTRP00000034722 9606.ENSP00000314407 ENSP00000314407 ENSMMUP00000008482 ENSPANP00000002848 ENSNLEP00000002322 ENSNLEP00000002322 GO.57446 HR3028 ENSPTRP00000034722 gi|22027500|ref|NP_004047.3|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]