SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000314649 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000314649
Domain Number 1 Region: 57-546
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-160
Family ALDH-like 0.000000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000314649   Gene: ENSG00000112294   Transcript: ENST00000348925
Sequence length 548
Comment pep:known chromosome:GRCh38:6:24494969:24534303:1 gene:ENSG00000112294 transcript:ENST00000348925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH
TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AEVNQGFLLDLDPLLLASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTT
TGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFL
VQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVV
TGGKRHQLGKNFFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLA
GYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEL
KYVCYGGL
Download sequence
Identical sequences X5D299
ENSP00000417687 ENSP00000314649 9606.ENSP00000314649 NP_733936.1.87134 NP_733936.1.92137 gi|25777721|ref|NP_733936.1| ENSP00000314649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]