SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000318144 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000318144
Domain Number 1 Region: 367-481,601-716
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.37e-55
Family Phosphate binding protein-like 0.00000000289
Further Details:      
 
Domain Number 2 Region: 9-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.72e-52
Family L-arabinose binding protein-like 0.009
Further Details:      
 
Domain Number 3 Region: 497-600
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000235
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318144   Gene: ENSG00000120251   Transcript: ENST00000323661
Sequence length 730
Comment pep:known chromosome:GRCh38:4:157221242:157362821:1 gene:ENSG00000120251 transcript:ENST00000323661 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTL
HVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS
AAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIG
KHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPG
AHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERA
LKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGND
TSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVG
DGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKK
PQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSE
STNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV
ERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTT
AEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLSGVT
FKTLLFVCCG
Download sequence
Identical sequences A0A2J8MUZ0 A0A2J8W0A9 F8W7L6
ENSP00000318144 ENSP00000318144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]