SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000318912 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000318912
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.7e-97
Family Carbonic anhydrase 0.000000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318912   Gene: ENSG00000185015   Transcript: ENST00000321764
Sequence length 262
Comment pep:known chromosome:GRCh38:8:85245527:85284073:1 gene:ENSG00000185015 transcript:ENST00000321764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKII
SNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELH
VVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNF
DLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAA
FLVSNHRPPQPLKGRKVRASFH
Download sequence
Identical sequences Q8N1Q1
ENSP00000318912 9606.ENSP00000318912 NP_940986.1.87134 NP_940986.1.92137 ENSP00000318912 gi|38348436|ref|NP_940986.1| ENSP00000318912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]