SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000320866 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000320866
Domain Number 1 Region: 19-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-62
Family Calnexin/calreticulin 0.0000523
Further Details:      
 
Domain Number 2 Region: 201-315
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.67e-46
Family P-domain of calnexin/calreticulin 0.000000604
Further Details:      
 
Weak hits

Sequence:  ENSP00000320866
Domain Number - Region: 310-348
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0807
Family Calnexin/calreticulin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000320866   Gene: ENSG00000179218   Transcript: ENST00000316448
Sequence length 417
Comment pep:known chromosome:GRCh38:19:12938607:12944489:1 gene:ENSG00000179218 transcript:ENST00000316448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDE
EKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQT
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL
Download sequence
Identical sequences H2NXQ5 P27797 V9HW88
9600.ENSPPYP00000010780 9606.ENSP00000320866 NP_004334.1.87134 NP_004334.1.92137 XP_002828791.1.23681 ENSP00000320866 gi|4757900|ref|NP_004334.1| GO.38212 ENSP00000320866 ENSP00000320866 ENSPPYP00000010780 ENSPPYP00000010780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]