SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000321334 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321334
Domain Number 1 Region: 1804-2039
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.26e-78
Family Eukaryotic proteases 0.0000000209
Further Details:      
 
Domain Number 2 Region: 1604-1708
Classification Level Classification E-value
Superfamily Kringle-like 2.03e-39
Family Kringle modules 0.00000576
Further Details:      
 
Domain Number 3 Region: 1042-1142
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-38
Family Kringle modules 0.00000598
Further Details:      
 
Domain Number 4 Region: 1377-1480
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-38
Family Kringle modules 0.00000377
Further Details:      
 
Domain Number 5 Region: 1491-1594
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-38
Family Kringle modules 0.00000823
Further Details:      
 
Domain Number 6 Region: 1262-1366
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-38
Family Kringle modules 0.00000194
Further Details:      
 
Domain Number 7 Region: 1157-1257
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-37
Family Kringle modules 0.00000113
Further Details:      
 
Domain Number 8 Region: 19-120
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-37
Family Kringle modules 0.0000119
Further Details:      
 
Domain Number 9 Region: 814-917
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-37
Family Kringle modules 0.00000904
Further Details:      
 
Domain Number 10 Region: 130-234
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-37
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 11 Region: 244-348
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-37
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 12 Region: 358-462
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-37
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 13 Region: 472-576
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-37
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 14 Region: 586-690
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-37
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 15 Region: 700-804
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-37
Family Kringle modules 0.00000836
Further Details:      
 
Domain Number 16 Region: 928-1031
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-37
Family Kringle modules 0.0000152
Further Details:      
 
Domain Number 17 Region: 1704-1802
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-32
Family Kringle modules 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321334   Gene: ENSG00000198670   Transcript: ENST00000316300
Sequence length 2040
Comment pep:known chromosome:GRCh38:6:160531483:160664259:-1 gene:ENSG00000198670 transcript:ENST00000316300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSAAPEQSHVVQDCYHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQH
NRTTENYPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTP
VPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEY
YPNAGLIMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEA
PSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL
IMNYCRNPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAP
TEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCR
NPDAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPG
VQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVA
APYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYH
GNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYT
RDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSY
RGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDAVAAPYCYTRDPGVR
WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYST
TVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNPDPVAAPYCYTRDPSVRWEYCNL
TQCSDAEGTAVAPPTITPIPSLEAPSEQAPTEQRPGVQECYHGNGQSYQGTYFITVTGRT
CQAWSSMTPHSHSRTPAYYPNAGLIKNYCRNPDPVAAPWCYTTDPSVRWEYCNLTRCSDA
EWTAFVPPNVILAPSLEAFFEQALTEETPGVQDCYYHYGQSYRGTYSTTVTGRTCQAWSS
MTPHQHSRTPENYPNAGLTRNYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCLVTESSVLA
TLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWH
QRTTEYYPNGGLTRNYCRNPDAEISPWCYTMDPNVRWEYCNLTQCPVTESSVLATSTAVS
EQAPTEQSPTVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTR
NYCRNPDAEIRPWCYTMDPSVRWEYCNLTQCPVMESTLLTTPTVVPVPSTELPSEEAPTE
NSTGVQDCYRGDGQSYRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYPNAGLTRNYCRNP
DAEIRPWCYTMDPSVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQ
DCYHGDGRSYRGISSTTVTGRTCQSWSSMIPHWHQRTPENYPNAGLTENYCRNPDSGKQP
WCYTTDPCVRWEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCYHGN
GQSYRGTFSTTVTGRTCQSWSSMTPHRHQRTPENYPNDGLTMNYCRNPDADTGPWCFTMD
PSIRWEYCNLTRCSDTEGTVVAPPTVIQVPSLGPPSEQDCMFGNGKGYRGKKATTVTGTP
CQEWAAQEPHRHSTFIPGTNKWAGLEKNYCRNPDGDINGPWCYTMNPRKLFDYCDIPLCA
SSSFDCGKPQVEPKKCPGSIVGGCVAHPHSWPWQVSLRTRFGKHFCGGTLISPEWVLTAA
HCLKKSSRPSSYKVILGAHQEVNLESHVQEIEVSRLFLEPTQADIALLKLSRPAVITDKV
MPACLPSPDYMVTARTECYITGWGETQGTFGTGLLKEAQLLVIENEVCNHYKYICAEHLA
RGTDSCQGDSGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYARVSRFVTWIEGMMRNN
Download sequence
Identical sequences NP_005568.2.87134 NP_005568.2.92137 ENSP00000321334 ENSP00000321334 ENSP00000395608 ENSP00000321334 9606.ENSP00000321334 gi|116292750|ref|NP_005568.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]