SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000323534 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000323534
Domain Number 1 Region: 1451-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.83e-27
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 1906-2073
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-26
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 1634-1801
Classification Level Classification E-value
Superfamily Fibronectin type III 6e-24
Family Fibronectin type III 0.00000972
Further Details:      
 
Domain Number 4 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-23
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 1265-1439
Classification Level Classification E-value
Superfamily Fibronectin type III 4.12e-23
Family Fibronectin type III 0.000007
Further Details:      
 
Domain Number 6 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 9.02e-22
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.46e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 1811-1901
Classification Level Classification E-value
Superfamily Fibronectin type III 2.86e-19
Family Fibronectin type III 0.00000341
Further Details:      
 
Domain Number 10 Region: 1173-1261
Classification Level Classification E-value
Superfamily Fibronectin type III 3.76e-17
Family Fibronectin type III 0.00000236
Further Details:      
 
Domain Number 11 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000085
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 12 Region: 2309-2352
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000183
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 13 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000314
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 14 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000317
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 15 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000116
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 16 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 17 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 18 Region: 2264-2307
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000506
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 19 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000628
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 20 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000249
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 21 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000353
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 22 Region: 2352-2393
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 23 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000119
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 24 Region: 2166-2242
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000157
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 25 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000204
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323534   Gene: ENSG00000115414   Transcript: ENST00000323926
Sequence length 2446
Comment pep:known chromosome:GRCh38:2:215360454:215436068:-1 gene:ENSG00000115414 transcript:ENST00000323926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLT
GLTRGATYNVIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDE
WERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLG
NGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEP
SPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences ENSP00000323534 ENSP00000323534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]