SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000323816 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000323816
Domain Number 1 Region: 123-179
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000017
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.073
Further Details:      
 
Domain Number 2 Region: 38-80
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000772
Family HLH, helix-loop-helix DNA-binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000323816   Gene: ENSG00000063438   Transcript: ENST00000316418
Sequence length 719
Comment pep:known chromosome:GRCh38:5:304176:438291:1 gene:ENSG00000063438 transcript:ENST00000316418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPD
IISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLL
ESLNGFALVVSAEGTIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMD
PPQVVFGQPPPLETGDDAILGRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFL
ARGSQAWQLRLCCPEPLMTMQFQGKLKFLFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSA
AEMKMRSALLRAKPRADTAATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQ
TDAGRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGPTK
PLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRNSPISHPPSPSPS
AYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPGAQRFATRGYPMEDMKLQGVPMP
PGDLCGPTLLLDVSIKMEKDSGCEGAADGCVPSQVWLGASDRSHPATFPTRMHLKTEPDS
RQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARG
RGEQSCTCRAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFLP
Download sequence
Identical sequences ENSP00000323816 gi|115430245|ref|NP_065782.2| ENSP00000323816 9606.ENSP00000323816 NP_065782.2.87134 NP_065782.2.92137 ENSP00000323816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]