SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000325473 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325473
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-34
Family ALDH-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325473   Gene: ENSG00000118514   Transcript: ENST00000349305
Sequence length 160
Comment pep:known chromosome:GRCh38:6:134918160:134950089:-1 gene:ENSG00000118514 transcript:ENST00000349305 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPS
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVVPGYTCRTCRFVT
Download sequence
Identical sequences ENSP00000325473 ENSP00000325473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]