SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000328358 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000328358
Domain Number 1 Region: 385-456
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.37e-21
Family Intermediate filament protein, coiled coil region 0.00063
Further Details:      
 
Domain Number 2 Region: 141-175
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000194
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 183-253
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000282
Family Intermediate filament protein, coiled coil region 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSP00000328358
Domain Number - Region: 273-375
Classification Level Classification E-value
Superfamily Prefoldin 0.000133
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000328358   Gene: ENSG00000185640   Transcript: ENST00000330553
Sequence length 535
Comment pep:known chromosome:GRCh38:12:52821447:52834295:-1 gene:ENSG00000185640 transcript:ENST00000330553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSVSRQTYSTKGGFSSNSASGGSGSQARTSFSSVTVSRSSGSGGGAHCGPGTGGFGSR
SLYNLGGHKSISVSVAGGALLGRALGGFGFGSRAFMGQGAGRQTFGPACPPGGIQEVTVN
QSLLTPLHVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQ
GQNLGVTRNNLEPLFEAYLGSMRSTLDRLQSERGRLDSELRNVQDLVEDFKNKYEDEINK
HTAAENEFVVLKKDVDAAYMGRMDLHGKVGTLTQEIDFLQQLYEMELSQVQTHVSNTNVV
LSMDNNRNLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKN
EIAELTRTIQRLQGEADAAKKQCQQLQTAIAEAEQRGELALKDAQKKLGDLDVALHQAKE
DLTRLLRDYQELMNVKLALDVEIATYRKLLESEESRMSGECPSAVSISVTGNSTTVCGGG
AASFGGGISLGGSGGATKGGFSTNVGYSTVKGGPVSAGTSILRKTTTVKTSSQRY
Download sequence
Identical sequences Q5XKE5
ENSP00000328358 ENSP00000328358 NP_787028.1.87134 NP_787028.1.92137 gi|32567786|ref|NP_787028.1| ENSP00000328358 9606.ENSP00000328358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]