SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000337053 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337053
Domain Number 1 Region: 359-592
Classification Level Classification E-value
Superfamily HCP-like 2.18e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 566-700
Classification Level Classification E-value
Superfamily HCP-like 9.42e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 6.1e-25
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337053   Gene: ENSG00000071537   Transcript: ENST00000336735
Sequence length 794
Comment pep:known chromosome:GRCh38:14:81471549:81533861:-1 gene:ENSG00000071537 transcript:ENST00000336735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGLTLLLCAVLLSLASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDISFLESPNPENKDYEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EASIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDMPAPRPPGPRPA
PPQQEGPPEQQPPQ
Download sequence
Identical sequences Q9UBV2
ENSP00000337053 gi|19923669|ref|NP_005056.3| 9606.ENSP00000337053 NP_005056.3.87134 NP_005056.3.92137 ENSP00000337053 ENSP00000337053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]