SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000337816 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000337816
Domain Number 1 Region: 314-509
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.15e-57
Family Hemopexin-like domain 0.0000135
Further Details:      
 
Domain Number 2 Region: 57-279
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.93e-46
Family Matrix metalloproteases, catalytic domain 0.0000247
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000337816   Gene: ENSG00000008516   Transcript: ENST00000336577
Sequence length 562
Comment pep:known chromosome:GRCh38:16:3046681:3060726:1 gene:ENSG00000008516 transcript:ENST00000336577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRLRLLALLLLLLAPPARAPKPSAQDVSLGVDWLTRYGYLPPPHPAQAQLQSPEKLRD
AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDVLGVAGLVRRRRRYALSGSVWKKRTL
TWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQ
DSYPFDGLGGTLAHAFFPGEHPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALG
LGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQ
PPASPTHSPSFPIPDRCEGNFDAIANIRGETFFFKGPWFWRLQPSGQLVSPRPARLHRFW
EGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGGARPLTELGLPPGEEVDAVF
SWPQNGKTYLVRGRQYWRYDEAAARPDPGYPRDLSLWEGAPPSPDDVTVSNAGDTYFFKG
AHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPSSGPRAPRPPKATPVSETCDCQCELNQAA
GRWPAPIPLLLLPLLVGGVASR
Download sequence
Identical sequences Q9NPA2
ENSP00000337816 NP_071913.1.87134 NP_071913.1.92137 ENSP00000337816 ENSP00000337816 9606.ENSP00000337816 gi|11968059|ref|NP_071913.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]