SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000339374 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000339374
Domain Number 1 Region: 41-188
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.17e-39
Family Galectin (animal S-lectin) 0.00029
Further Details:      
 
Domain Number 2 Region: 210-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-18
Family Galectin (animal S-lectin) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000339374   Gene: ENSG00000133317   Transcript: ENST00000340246
Sequence length 337
Comment pep:known chromosome:GRCh38:11:63506363:63516774:1 gene:ENSG00000133317 transcript:ENST00000340246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPSGGRAPGTRIYSWSCPTVMSPGEKLDPIPDSFILQPPVFHPVVPYVTTIFGGLHAG
KMVMLQGVVPLDAHSRFQVDFQCGCSLCPRPDIAFHFNPRFHTTKPHVICNTLHGGRWQR
EARWPHLALRRGSSFLILFLFGNEEVKVSVNGQHFLHFRYRLPLSHVDTLGIFGDILVEA
VGFLNINPFVEGSREYPAGHPFLLMSPRLEVPCSHALPQGLSPGQVIIVRGLVLQEPKHF
TVSLRDQAAHAPVTLRASFADRTLAWISRWGQKKLISAPFLFYPQRFFEVLLLFQEGGLK
LALNGQGLGATSMNQQALEQLRELRISGSVQLYCVHS
Download sequence
Identical sequences A0A140VK26
ENSP00000339374 ENSP00000339374 NP_001136007.1.87134 NP_001136007.1.92137 gi|216547809|ref|NP_001136007.1| ENSP00000339374 9606.ENSP00000378116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]