SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000340352 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340352
Domain Number 1 Region: 50-166
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-31
Family Inorganic pyrophosphatase 0.000081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340352   Gene: ENSG00000138777   Transcript: ENST00000354147
Sequence length 168
Comment pep:known chromosome:GRCh38:4:105369565:105474050:-1 gene:ENSG00000138777 transcript:ENST00000354147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFNIDDVKKF
KPGYLEATLNWFRLYKVPDGKPENQFAFNGEFKNKAFALEVIKSTHQCWKALLMKKCNGG
AINCTNVQISDSPFRCTQEEARSLVESVSSSPNKESNEEEQVWHFLGK
Download sequence
Identical sequences A0A2I2ZNJ3 A0A2I3SK94
NP_789843.2.87134 NP_789843.2.92137 XP_004040277.1.27298 XP_014200198.1.60992 ENSP00000340352 gi|77812682|ref|NP_789843.2| ENSP00000340352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]