SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000340679 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000340679
Domain Number 1 Region: 438-774
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.15e-110
Family PDEase 0.00000168
Further Details:      
 
Weak hits

Sequence:  ENSP00000340679
Domain Number - Region: 94-160
Classification Level Classification E-value
Superfamily CheY-like 0.000211
Family CheY-related 0.0084
Further Details:      
 
Domain Number - Region: 238-278
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0586
Family Heme-binding PAS domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000340679   Gene: ENSG00000073417   Transcript: ENST00000339708
Sequence length 783
Comment pep:known chromosome:GRCh38:15:84981981:85138032:1 gene:ENSG00000073417 transcript:ENST00000339708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAPSIHISERLVAEDAPSPAAPPLSSGGPRLPQGQKTAALPRTRGAGLLESELRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFISAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRFIQEW
QGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKISECVQSDTHTD
NQTGKHKDRRKGSLDVKAVASRATEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQES
SPMPVTEALDRVLEILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTK
NTQMVSSNIITPISLDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFG
ICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDE
VAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIF
KNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEVINT
MLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQGLPVVMPV
FDRNTCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRNLRP
PPE
Download sequence
Identical sequences ENSP00000340679 gi|47132537|ref|NP_775656.1| ENSP00000340679 NP_775656.1.87134 NP_775656.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]