SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341136 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341136
Domain Number 1 Region: 148-219,266-523
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 9.25e-96
Family NadC C-terminal domain-like 0.0000155
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.65e-36
Family NadC N-terminal domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341136   Gene: ENSG00000147813   Transcript: ENST00000340490
Sequence length 584
Comment pep:known chromosome:GRCh38:8:143574787:143578339:-1 gene:ENSG00000147813 transcript:ENST00000340490 gene_biotype:protein_coding transcript_biotype:non_stop_decay
Sequence
MAAEQDPEARAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPGV
DLAAKAQVWLEQVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRKVFRAAAAQFQVPWLESVLIVVSNNIDE
EALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSPLMDMLQLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPLLRLCLQQ
GQLCEPLPSLAESRALAQLSLSRLSPEHRRLRSPAQYQVGGRPTLSFCPVRPRPHPAHRS
CPLLPAGGAVREAAGPGEQSVCGAVPLRLGAGLTGNNTNHSLFP
Download sequence
Identical sequences G5E977
ENSP00000341136 ENSP00000341136 ENSP00000405670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]