SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000341762 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000341762
Domain Number 1 Region: 75-131
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-17
Family Fibronectin type II module 0.0046
Further Details:      
 
Domain Number 2 Region: 44-87
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000248
Family Fibronectin type II module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000341762   Gene: ENSG00000188334   Transcript: ENST00000344839
Sequence length 132
Comment pep:known chromosome:GRCh38:19:47968046:47992170:-1 gene:ENSG00000188334 transcript:ENST00000344839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLMLLFVETTRNSSACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCI
KSKARHKWCSLNKTYEGYWKFCSAEDFANCVFPFWYRRLIYWECTDDGEAFGKKWCSLTK
NFNKDRIWKYCE
Download sequence
Identical sequences Q075Z2
gi|190358548|ref|NP_001121798.1| NP_001121798.1.87134 NP_001121798.1.92137 XP_016881607.1.92137 ENSP00000341762 ENSP00000341762 9606.ENSP00000341762 ENSP00000341762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]