SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000343088 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343088
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.62e-92
Family Carbonic anhydrase 0.0000000000825
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343088   Gene: ENSG00000074410   Transcript: ENST00000344366
Sequence length 343
Comment pep:known chromosome:GRCh38:15:63324688:63381835:-1 gene:ENSG00000074410 transcript:ENST00000344366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQGIILSLALA
GILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Download sequence
Identical sequences ENSP00000343088 NP_996808.1.87134 NP_996808.1.92137 gi|45935383|ref|NP_996808.1| ENSP00000343088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]