SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000343129 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343129
Domain Number 1 Region: 214-278
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.1e-16
Family B-box zinc-binding domain 0.0000318
Further Details:      
 
Weak hits

Sequence:  ENSP00000343129
Domain Number - Region: 88-241
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0905
Family Transferrin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343129   Gene: ENSG00000137699   Transcript: ENST00000341846
Sequence length 588
Comment pep:known chromosome:GRCh38:11:120111275:120138453:-1 gene:ENSG00000137699 transcript:ENST00000341846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAAEGKSLGSAL
KPGEGRSALFAGNEWRRPIIQFVESGDDKNSNYFSMDSMEGKRSPYAGLQLGAAKKPPVT
FAEKGELRKSIFSESRKPTVSIMEPGETRRNSYPRADTGLFSRSKSGSEEVLCDSCIGNK
QKAVKSCLVCQASFCELHLKPHLEGAAFRDHQLLEPIRDFEARKCPVHGKTMELFCQTDQ
TCICYLCMFQEHKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIK
SFTTNEKAILEQNFRDLVRDLEKQKEEVRAALEQREQDAVDQVKVIMDALDERAKVLHED
KQTREQLHSISDSVLFLQEFGALMSNYSLPPPLPTYHVLLEGEGLGQSLGNFKDDLLNVC
MRHVEKMCKADLSRNFIERNHMENGGDHRYVNNYTNSFGGEWSAPDTMKRYSMYLTPKGG
VRTSYQPSSPGRFTKETTQKNFNNLYGTKGNYTSRVWEYSSSIQNSDNDLPVVQGSSSFS
LKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP
Download sequence
Identical sequences A0A024R3J1 Q14134
ENSP00000343129 ENSP00000343129 NP_036233.2.87134 NP_036233.2.92137 9606.ENSP00000343129 ENSP00000343129 gi|17402909|ref|NP_036233.2| 400568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]