SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000343294 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343294
Domain Number 1 Region: 25-401
Classification Level Classification E-value
Superfamily ALDH-like 5.33e-132
Family ALDH-like 0.000000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343294   Gene: ENSG00000184254   Transcript: ENST00000346623
Sequence length 405
Comment pep:novel chromosome:GRCh38:15:100879875:100916626:1 gene:ENSG00000184254 transcript:ENST00000346623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAAGFPP
GVVNIVPGFGPTVGAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPC
IVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPF
DVKTEQGPQIDQKQFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRI
AKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINC
YNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
Download sequence
Identical sequences H0Y2X5
ENSP00000343294 ENSP00000343294 NP_001280744.1.87134 NP_001280744.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]