SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000343686 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343686
Domain Number 1 Region: 188-301
Classification Level Classification E-value
Superfamily POZ domain 2.62e-27
Family BTB/POZ domain 0.0059
Further Details:      
 
Domain Number 2 Region: 41-126
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000353
Family BTB/POZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343686   Gene: ENSG00000189195   Transcript: ENST00000342818
Sequence length 378
Comment pep:known chromosome:GRCh38:1:92080336:92147836:1 gene:ENSG00000189195 transcript:ENST00000342818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDV
TFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYS
SNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFIS
NDNYDLEPASELGEDLLKLYVKPCCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWA
ESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYIL
RRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPP
EIQKSCLNMLIQSLVSIT
Download sequence
Identical sequences A0A2J8VCZ1 Q5XKL5
9600.ENSPPYP00000001341 9606.ENSP00000343686 ENSP00000343686 ENSP00000359408 ENSP00000343686 NP_899065.2.87134 NP_899065.2.92137 gi|224465242|ref|NP_899065.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]