SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343905 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343905
Domain Number 1 Region: 78-151
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-21
Family Dual specificity phosphatase-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343905   Gene: ENSG00000162999   Transcript: ENST00000342619
Sequence length 166
Comment pep:known chromosome:GRCh38:2:183078559:183095899:1 gene:ENSG00000162999 transcript:ENST00000342619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDL
SSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKDGVVLVHCNAGVSRAAAIVIGFLMNSEQT
SFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS
Download sequence
Identical sequences A0A2I3TGB1
9598.ENSPTRP00000021736 gi|214832050|ref|NP_001135786.1| ENSP00000343905 ENSP00000343905 NP_001135786.1.87134 NP_001135786.1.92137 XP_001160177.1.37143 ENSPTRP00000021736 ENSPTRP00000021736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]