SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345008 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345008
Domain Number 1 Region: 155-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.27e-18
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 15-70,112-168
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000691
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 280-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000928
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345008   Gene: ENSG00000140092   Transcript: ENST00000342058
Sequence length 448
Comment pep:known chromosome:GRCh38:14:91870042:91947823:-1 gene:ENSG00000140092 transcript:ENST00000342058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGIKRILTVTILALCLPSPGNAQAQCTNGFDLDRQSGQCLDIDECRTIPEACRGDMMCV
NQNGGYLCIPRTNPVYRGPYSNPYSTPYSGPYPAAAPPLSAPNYPTISRPLICRFGYQMD
ESNQCVDVDECATDSHQCNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQL
CANVPGSYSCTCNPGFTLNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEE
DGVHCSDMDECSFSEFLCQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCN
LQQTCYNLQGGFKCIDPIRCEEPYLRISDNRCMCPAENPGCRDQPFTILYRDMDVVSGRS
VPADIFQMQATTRYPGAYYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPREIQLDL
EMITVNTVINFRGSSVIRLRIYVSQYPF
Download sequence
Identical sequences A0A024R6G3 G3SEY7 H2NM18 K7DKI2 Q9UBX5
GO.42444 ENSP00000345008 ENSPPYP00000006903 NP_006320.2.87134 NP_006320.2.92137 XP_001146061.1.37143 XP_003832822.1.60992 XP_004055634.1.27298 XP_008956454.1.60992 XP_009426573.1.37143 XP_018865554.1.27298 gi|19743803|ref|NP_006320.2| 9600.ENSPPYP00000006903 9606.ENSP00000345008 ENSPPYP00000006903 ENSGGOP00000026671 ENSP00000345008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]