SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345585 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345585
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.98e-46
Family ets domain 0.00000815
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345585   Gene: ENSG00000126767   Transcript: ENST00000343894
Sequence length 95
Comment pep:known chromosome:GRCh38:X:47635522:47650604:-1 gene:ENSG00000126767 transcript:ENST00000343894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPESHCAP
Download sequence
Identical sequences A0A1U7UCV9 A0A2I2YL31 A0A2I3GNY9 A0A2I3S2V0 A0A2J8WIE8 A0A2K5HRL6 A0A2K5LUJ4 A0A2K5WYP8 A0A2K6BZW3 A0A2K6K5I4 F6R8K3
ENSMMUP00000025531 NP_001244097.1.87134 NP_001244097.1.92137 XP_008066563.1.4292 XP_011794111.1.43180 ENSP00000345585 ENSP00000345585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]