SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000345774 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345774
Domain Number 1 Region: 4-429
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-127
Family ALDH-like 0.0000000000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345774   Gene: ENSG00000072210   Transcript: ENST00000339618
Sequence length 508
Comment pep:known chromosome:GRCh38:17:19648751:19677596:1 gene:ENSG00000072210 transcript:ENST00000339618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KKYQAVLRRKALLIFLVVHRLRWSSKQR
Download sequence
Identical sequences ENSP00000345774 ENSP00000461916 ENSP00000378942 9606.ENSP00000345774 HR6795 ENSP00000345774 ENSP00000461916 gi|73466520|ref|NP_001026976.1| NP_001026976.1.87134 NP_001026976.1.92137 XP_011522034.1.92137 XP_011522035.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]