SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000345874 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345874
Domain Number 1 Region: 143-173,206-239
Classification Level Classification E-value
Superfamily RILP dimerisation region 2.62e-17
Family RILP dimerisation region 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSP00000345874
Domain Number - Region: 27-100
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00966
Family Spectrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345874   Gene: ENSG00000188026   Transcript: ENST00000340724
Sequence length 283
Comment pep:putative chromosome:GRCh38:12:123472068:123514428:-1 gene:ENSG00000188026 transcript:ENST00000340724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMSERERQVMKKLKEVVDKQRDEIRAKDRELGLKNEDVEALQQQQTRLMKINHDLRHRV
TVVEAQGKALIEQKVELEADLQTKEQEMGSLRAELGKLRERLQGEHSQNGEEEPETEPVG
EESISDAEKVAMDLKDPNRPRFTLQELRDVLHERNELKSKVFLLQEELAYYKRFPHETTS
NMRPEVLFILSMAKFPALRMELGTHEEMEEENRIPQPPPIAHPRTSPQPESGIKRLFSFF
SRDKKRLANTQRNVHIQESFGQWANTHRDDGYTEQGQEALQHL
Download sequence
Identical sequences ENSP00000345874 ENSP00000345874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]