SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000346164 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000346164
Domain Number 1 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.86e-24
Family Hairpin loop containing domain 0.00000363
Further Details:      
 
Domain Number 2 Region: 114-166
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000604
Family Kringle modules 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000346164   Gene: ENSG00000019991   Transcript: ENST00000354224
Sequence length 184
Comment pep:known chromosome:GRCh38:7:81755121:81769971:-1 gene:ENSG00000019991 transcript:ENST00000354224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIK
TKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSGGDDCLVESTFYSIPFWGH
NSAR
Download sequence
Identical sequences A0A2J8VLJ5 C9WSJ3
ENSP00000346164 ENSP00000346164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]