SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000346354 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000346354
Domain Number 1 Region: 66-287
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.45e-67
Family Mismatch glycosylase 0.0000282
Further Details:      
 
Domain Number 2 Region: 332-471
Classification Level Classification E-value
Superfamily Nudix 9.89e-30
Family MutY C-terminal domain-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000346354   Gene: ENSG00000132781   Transcript: ENST00000354383
Sequence length 522
Comment pep:known chromosome:GRCh38:1:45329242:45340080:-1 gene:ENSG00000132781 transcript:ENST00000354383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRAAVGSGHRKQAASQEGRQKHAKNNSQAKPSACDAGLARQPEEVVLQASVSSYHLF
RDVAEVTAFRGSLLSWYDQEKRDLPWRRRAEDEMDLDRRAYAVWVSEVMLQQTQVATVIN
YYTGWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEELGGHMPRTAET
LQQLLPGVGRYTAGAIASIAFGQATGVVDGNVARVLCRVRAIGADPSSTLVSQQLWGLAQ
QLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVESLCRARQRVEQEQLLASGSLSGSP
DVEECAPNTGQCHLCLPPSEPWDQTLGVVNFPRKASRKPPREESSATCVLEQPGALGAQI
LLVQRPNSGLLAGLWEFPSVTWEPSEQLQRKALLQELQRWAGPLPATHLRHLGEVVHTFS
HIKLTYQVYGLALEGQTPVTTVPPGARWLTQEEFHTAAVSTAMKKVFRVYQGQQPGTCMG
SKRSQVSSPCSRKKPRMGQQVLDNFFRSHISTDAHSLNSAAQ
Download sequence
Identical sequences E5KP28
ENSP00000346354 gi|115298650|ref|NP_001041637.1| ENSP00000346354 NP_001041637.1.87134 NP_001041637.1.92137 XP_016856823.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]