SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347776 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347776
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-20
Family PDZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347776   Gene: ENSG00000196923   Transcript: ENST00000355572
Sequence length 222
Comment pep:known chromosome:GRCh38:5:177490246:177497573:-1 gene:ENSG00000196923 transcript:ENST00000355572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFKVVLEGPAPWGFRLQGGKDFNVPLSISRLTPGGKAAQAGVAVGDWVLSIDGENAGS
LTHIEAQNKIRACGERLSLGLSRAQPVQSKPQKASAPAADPPRYTFAPSVSLNKTARPFG
APPPADSAPQQNGQPLRPLVPDASKQRLMENTEDWRPRPGTGQSRSFRILAHLTGTEFMQ
DPDEEHLKKSREKYVLELQSPRYTRLRDWHHQRSAHVLNVQS
Download sequence
Identical sequences A0A2J8RDW4 K7AB04
ENSP00000347776 ENSP00000347776 NP_998801.1.87134 NP_998801.1.92137 XP_008956634.1.60992 gi|47157328|ref|NP_998801.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]