SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348013 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000348013
Domain Number - Region: 185-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0387
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348013   Gene: ENSG00000132326   Transcript: ENST00000355768
Sequence length 404
Comment pep:known chromosome:GRCh38:2:238261810:238277936:-1 gene:ENSG00000132326 transcript:ENST00000355768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGADVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPLWSMCSGADSFTQECMEEKSFFCRVSVRKSHENEIRYHPFRMTPYLVKVRD
QQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDESPAVRRAAFRLF
SHSVSRPERRVHHVGHQLVQLHQPMEQENLLHHWEAQSQGGPFE
Download sequence
Identical sequences ENSP00000254658 ENSP00000348013 ENSP00000348013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]