SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348285 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348285
Domain Number 1 Region: 1360-1531
Classification Level Classification E-value
Superfamily Fibronectin type III 1.59e-27
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 1725-1892
Classification Level Classification E-value
Superfamily Fibronectin type III 3.37e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 1544-1715
Classification Level Classification E-value
Superfamily Fibronectin type III 6.64e-25
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 4 Region: 909-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 2.66e-23
Family Fibronectin type III 0.00056
Further Details:      
 
Domain Number 5 Region: 726-891
Classification Level Classification E-value
Superfamily Fibronectin type III 1.23e-21
Family Fibronectin type III 0.00072
Further Details:      
 
Domain Number 6 Region: 1175-1348
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-21
Family Fibronectin type III 0.000007
Further Details:      
 
Domain Number 7 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 8 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 1.37e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 9 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000785
Family Fibronectin type I module 0.0021
Further Details:      
 
Domain Number 10 Region: 2159-2202
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 11 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000288
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 12 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000298
Family Fibronectin type III 0.00000288
Further Details:      
 
Domain Number 13 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000109
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 14 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 15 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000236
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 16 Region: 2114-2157
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000471
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 17 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000576
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000222
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 19 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000327
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 2202-2243
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 21 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000111
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 22 Region: 2028-2092
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000433
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 23 Region: 1092-1180
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000017
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348285   Gene: ENSG00000115414   Transcript: ENST00000356005
Sequence length 2296
Comment pep:known chromosome:GRCh38:2:215360866:215436068:-1 gene:ENSG00000115414 transcript:ENST00000356005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDTTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSD
NAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIA
PRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLL
IGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISV
KWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGE
SQPLVQTAVTTIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEINL
APDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTI
TISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNA
RSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVPR
PRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEI
LDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIR
HRPRPYPPNVGEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTS
EYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNVIVEALKDQQRHKVREEVVTV
GNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRW
CHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQK
EYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIE
CFMPLDVQADREDSRE
Download sequence
Identical sequences ENSP00000348285 ENSP00000348285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]