SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000348886 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000348886
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSP00000348886
Domain Number - Region: 208-322
Classification Level Classification E-value
Superfamily ALDH-like 0.0285
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000348886   Gene: ENSG00000165283   Transcript: ENST00000356493
Sequence length 356
Comment pep:known chromosome:GRCh38:9:35099891:35103157:-1 gene:ENSG00000165283 transcript:ENST00000356493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVKMS
Download sequence
Identical sequences H2PRU3 K7DCP2 Q9UJZ1
ENSGGOP00000003158 9598.ENSPTRP00000035756 9600.ENSPPYP00000021405 9606.ENSP00000348886 ENSP00000348886 ENSPPYP00000021405 ENSP00000348886 ENSGGOP00000003158 NP_038470.1.87134 NP_038470.1.92137 XP_002819699.1.23681 XP_003829867.1.60992 XP_004048035.1.27298 XP_520553.2.37143 ENSPTRP00000035756 ENSPPYP00000021405 ENSPTRP00000035756 gi|7305503|ref|NP_038470.1| ENSP00000348886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]