SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000349437 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349437
Domain Number 1 Region: 169-318
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-42
Family Mannose 6-phosphate receptor domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 322-466
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.16e-42
Family Mannose 6-phosphate receptor domain 0.000000596
Further Details:      
 
Domain Number 3 Region: 626-761
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-39
Family Mannose 6-phosphate receptor domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1515-1646
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.98e-37
Family Mannose 6-phosphate receptor domain 0.000000115
Further Details:      
 
Domain Number 5 Region: 1365-1506
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.19e-36
Family Mannose 6-phosphate receptor domain 0.00056
Further Details:      
 
Domain Number 6 Region: 762-923
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-33
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 7 Region: 475-617
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.09e-32
Family Mannose 6-phosphate receptor domain 0.0014
Further Details:      
 
Domain Number 8 Region: 1076-1218
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.01e-31
Family Mannose 6-phosphate receptor domain 0.0013
Further Details:      
 
Domain Number 9 Region: 45-166
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-31
Family Mannose 6-phosphate receptor domain 0.000000676
Further Details:      
 
Domain Number 10 Region: 1222-1362
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.01e-31
Family Mannose 6-phosphate receptor domain 0.00016
Further Details:      
 
Domain Number 11 Region: 1651-1796
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.22e-30
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2132-2279
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-29
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 13 Region: 2003-2130
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.57e-28
Family Mannose 6-phosphate receptor domain 0.00084
Further Details:      
 
Domain Number 14 Region: 933-1077
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.44e-20
Family Mannose 6-phosphate receptor domain 0.0048
Further Details:      
 
Domain Number 15 Region: 1803-1896,1945-1988
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-20
Family Mannose 6-phosphate receptor domain 0.0033
Further Details:      
 
Domain Number 16 Region: 1895-1944
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-16
Family Fibronectin type II module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349437   Gene: ENSG00000197081   Transcript: ENST00000356956
Sequence length 2491
Comment pep:known chromosome:GRCh38:6:159969099:160106551:1 gene:ENSG00000197081 transcript:ENST00000356956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAAGRSPHLGPAPARRPQRSLLLLQLLLLVAAPGSTQAQAAPFPELCSYTWEAVDTKN
NVLYKINICGSVDIVQCGPSSAVCMHDLKTRTYHSVGDSVLRSATRSLLEFNTTVSCDQQ
GTNHRVQSSIAFLCGKTLGTPEFVTATECVHYFEWRTTAACKKDIFKANKEVPCYVFDEE
LRKHDLNPLIKLSGAYLVDDSDPDTSLFINVCRDIDTLRDPGSQLRACPPGTAACLVRGH
QAFDVGQPRDGLKLVRKDRLVLSYVREEAGKLDFCDGHSPAVTITFVCPSERREGTIPKL
TAKSNCRYEIEWITEYACHRDYLESKTCSLSGEQQDVSIDLTPLAQSGGSSYISDGKEYL
FYLNVCGETEIQFCNKKQAAVCQVKKSDTSQVKAAGRYHNQTLRYSDGDLTLIYFGGDEC
SSGFQRMSVINFECNKTAGNDGKGTPVFTGEVDCTYFFTWDTEYACVKEKEDLLCGATDG
KKRYDLSALVRHAEPEQNWEAVDGSQTETEKKHFFINICHRVLQEGKARGCPEDAAVCAV
DKNGSKNLGKFISSPMKEKGNIQLSYSDGDDCGHGKKIKTNITLVCKPGDLESAPVLRTS
GEGGCFYEFEWHTAAACVLSKTEGENCTVFDSQAGFSFDLSPLTKKNGAYKVETKKYDFY
INVCGPVSVSPCQPDSGACQVAKSDEKTWNLGLSNAKLSYYDGMIQLNYRGGTPYNNERH
TPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVTDPSTLEQYDL
SSLAKSEGGLGGNWYAMDNSGEHVTWRKYYINVCRPLNPVPGCNRYASACQMKYEKDQGS
FTEVVSISNLGMAKTGPVVEDSGSLLLEYVNGSACTTSDGRQTTYTTRIHLVCSRGRLNS
HPIFSLNWECVVSFLWNTEAACPIQTTTDTDQACSIRDPNSGFVFNLNPLNSSQGYNVSG
IGKIFMFNVCGTMPVCGTILGKPASGCEAETQTEELKNWKPARPVGIEKSLQLSTEGFIT
LTYKGPLSAKGTADAFIVRFVCNDDVYSGPLKFLHQDIDSGQGIRNTYFEFETALACVPS
PVDCQVTDLAGNEYDLTGLSTVRKPWTAVDTSVDGRKRTFYLSVCNPLPYIPGCQGSAVG
SCLVSEGNSWNLGVVQMSPQAAANGSLSIMYVNGDKCGNQRFSTRITFECAQISGSPAFQ
LQDGCEYVFIWRTVEACPVVRVEGDNCEVKDPRHGNLYDLKPLGLNDTIVSAGEYTYYFR
VCGKLSSDVCPTSDKSKVVSSCQEKREPQGFHKVAGLLTQKLTYENGLLKMNFTGGDTCH
KVYQRSTAIFFYCDRGTQRPVFLKETSDCSYLFEWRTQYACPPFDLTECSFKDGAGNSFD
LSSLSRYSDNWEAITGTGDPEHYLINVCKSLAPQAGTEPCPPEAAACLLGGSKPVNLGRV
RDGPQWRDGIIVLKYVDGDLCPDGIRKKSTTIRFTCSESQVNSRPMFISAVEDCEYTFAW
PTATACPMKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCP
PGVGACFGQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEARP
TNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIVDLSPLIHRTGGYEAYDESE
DDASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPIDGPPIDIGRVAGPPILNPIANEI
YLNFESSTPCLADKHFNYTSLIAFHCKRGVSMGTPKLLRTSECDFVFEWETPVVCPDEVR
MDGCTLTDEQLLYSFNLSSLSTSTFKVTRDSRTYSVGVCTFAVGPEQGGCKDGGVCLLSG
TKGASFGRLQSMKLDYRHQDEAVVLSYVNGDRCPPETDDGVPCVFPFIFNGKSYEECIIE
SRAKLWCSTTADYDRDHEWGFCRHSNSYRTSSIIFKCDEDEDIGRPQVFSEVRGCDVTFE
WKTKVVCPPKKLECKFVQKHKTYDLRLLSSLTGSWSLVHNGVSYYINLCQKIYKGPLGCS
ERASICRRTTTGDVQVLGLVHTQKLGVIGDKVVVTYSKGYPCGGNKTASSVIELTCTKTV
GRPAFKRFDIDSCTYYFSWDSRAACAVKPQEVQMVNGTITNPINGKSFSLGDIYFKLFRA
SGDMRTNGDNYLYEIQLSSITSSRNPACSGANICQVKPNDQHFSRKVGTSDKTKYYLQDG
DLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVEDGIPEFSHETADCQYLFSWYTSAVCPL
GVGFDSENPGDDGQMHKGLSERSQAVGAVLSLLLVALTCCLLALLLYKKERRETVISKLT
TCCRRSSNVSYKYSKVNKEEETDENETEWLMEEIQLPPPRQGKEGQENGHITTKSVKALS
SLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHPVRNAQSNALQEREDDRVGLVRGEKAR
KGKSSSAQQKTVSSTKLVSFHDDSDEDLLHI
Download sequence
Identical sequences P11717
9606.ENSP00000349437 ENSP00000349437 ENSP00000349437 ENSP00000349437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]