SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000351644 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000351644
Domain Number 1 Region: 104-184,253-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.5e-36
Family G proteins 0.00039
Further Details:      
 
Domain Number 2 Region: 257-285,453-524
Classification Level Classification E-value
Superfamily TrmE connector domain 1.83e-18
Family TrmE connector domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000351644   Gene: ENSG00000130299   Transcript: ENST00000358792
Sequence length 524
Comment pep:known chromosome:GRCh38:19:17337555:17342022:1 gene:ENSG00000130299 transcript:ENST00000358792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLAAQAARGPRRLCTRRSSGAPAPGSGATIFALSSGQGRCGIAVIRTSGPASGH
ALRILTAPRDLPLARHASLRLLSDPRSGEPLDRALVLWFPGPQSFTGEDCVEFHVHGGPA
VVSGVLQALGSVPGLRPAEAGEFTRRAFANGKLNLTEVEGLADLIHAETEAQRRQALRQL
DGELGHLCRGWAETLTKALAHVEAYIDFGEDDNLEEGVLEQGGSTWWWGRKTPHISPQRL
PSLSLSACLLSPTADIEVRALQVALGAHLRDARRGQRLRSGVHVVVTGPPNAGKSSLVNL
LSRKPVSIVSPEPGTTRDVLETPVDLAGFPVLLSDTAGLREGVGPVEQEGVRRARERLEQ
ADLILAMLDASDLASPSSCNFLATVVASVGAQSPSDSSQRLLLVLNKSDLLSPEGPGPGP
DLPPHLLLSCLTGEGLDGLLEALRKELAAVCGDPSTDPPLLTRARHQHHLQGCLDALGHY
KQSKDLALAAEALRVARGHLTRLTGGGGTEEILDIIFQDFCVGK
Download sequence
Identical sequences gi|193082988|ref|NP_598399.2| ENSP00000351644 ENSP00000313818 NP_598399.2.87134 NP_598399.2.92137 ENSP00000351644 HR6680 9606.ENSP00000351644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]