SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000353231 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000353231
Domain Number 1 Region: 269-351
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.4e-22
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 2 Region: 180-260
Classification Level Classification E-value
Superfamily EF-hand 4.2e-17
Family Polcalcin 0.057
Further Details:      
 
Domain Number 3 Region: 2-89
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000746
Family Spectrin repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSP00000353231
Domain Number - Region: 132-197
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353231   Gene: ENSG00000127603   Transcript: ENST00000360115
Sequence length 543
Comment pep:novel chromosome:GRCh38:1:39453837:39486987:1 gene:ENSG00000127603 transcript:ENST00000360115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRV
KALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPM
PILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEEQLCLELKEFANFDFDVW
RKKYMRWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDR
DGDGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRF
FLGNQFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILP
EGASQGMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSS
GSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRAS
SRRGSDASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPG
PKR
Download sequence
Identical sequences H0Y314
ENSP00000353231 ENSP00000353231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]