SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000353767 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000353767
Domain Number 1 Region: 330-524
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-65
Family Hemopexin-like domain 0.00000509
Further Details:      
 
Domain Number 2 Region: 107-294
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.02e-44
Family Matrix metalloproteases, catalytic domain 0.0000725
Further Details:      
 
Domain Number 3 Region: 42-115
Classification Level Classification E-value
Superfamily PGBD-like 3.3e-17
Family MMP N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000353767   Gene: ENSG00000198598   Transcript: ENST00000360564
Sequence length 603
Comment pep:known chromosome:GRCh38:12:131828393:131851771:1 gene:ENSG00000198598 transcript:ENST00000360564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFG
YLPPADPTTGQLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQ
ARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAG
SAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGM
DLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESV
SPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFKGKYFWRLTRD
RHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRP
VSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLD
DAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAE
GPRAPPGQHDQSRSEDGYEVCSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQA
LTL
Download sequence
Identical sequences Q9ULZ9
ENSP00000353767 ENSP00000353767 ENSP00000353767 NP_057239.4.87134 NP_057239.4.92137 9606.ENSP00000353767 gi|112382270|ref|NP_057239.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]