SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000354573 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000354573
Domain Number 1 Region: 62-294
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.18e-86
Family Calponin-homology domain, CH-domain 0.000000993
Further Details:      
 
Domain Number 2 Region: 4213-4370
Classification Level Classification E-value
Superfamily Spectrin repeat 2.99e-31
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 3223-3383
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-28
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 4 Region: 4649-4799
Classification Level Classification E-value
Superfamily Spectrin repeat 3.02e-28
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 3334-3490
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-26
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 310-426
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-24
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 7 Region: 5162-5238
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.22e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 8 Region: 2788-2945
Classification Level Classification E-value
Superfamily Spectrin repeat 4.13e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 9 Region: 4759-4885
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-22
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 10 Region: 4452-4590
Classification Level Classification E-value
Superfamily Spectrin repeat 4.44e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 11 Region: 3783-3927
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 12 Region: 4104-4226
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-19
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 13 Region: 4868-4987
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-19
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 14 Region: 3443-3588
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 15 Region: 1900-2029
Classification Level Classification E-value
Superfamily Spectrin repeat 3.4e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 16 Region: 3661-3818
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 17 Region: 4335-4442
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 18 Region: 1227-1353,1380-1406
Classification Level Classification E-value
Superfamily Spectrin repeat 5.83e-16
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 19 Region: 5073-5153
Classification Level Classification E-value
Superfamily EF-hand 7.05e-16
Family Polcalcin 0.057
Further Details:      
 
Domain Number 20 Region: 3002-3162
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000178
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 21 Region: 2455-2579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000276
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 22 Region: 2679-2799
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000544
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 23 Region: 1764-1887
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000264
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 24 Region: 2363-2467
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000132
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 25 Region: 682-784
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000444
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 26 Region: 2229-2328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 27 Region: 2010-2149
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 28 Region: 4011-4121
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000136
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 29 Region: 3931-4038
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000432
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 30 Region: 591-680
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000694
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 31 Region: 1502-1659
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 32 Region: 2587-2688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000004
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 33 Region: 1424-1540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000125
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000354573
Domain Number - Region: 2159-2262
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000547
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 789-862
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0106
Family Spectrin repeat 0.0089
Further Details:      
 
Domain Number - Region: 3137-3215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.022
Further Details:      
 
Domain Number - Region: 5029-5090
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0336
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000354573   Gene: ENSG00000127603   Transcript: ENST00000361689
Sequence length 5430
Comment pep:known chromosome:GRCh38:1:39084167:39486987:1 gene:ENSG00000127603 transcript:ENST00000361689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSDEETLSERSCRSERSCRSERSYRSERSGSLSPCPPGDTLPWNLPLHEQKKRKSQDS
VLDPAERAVVRVADERDRVQKKTFTKWVNKHLMKVRKHINDLYEDLRDGHNLISLLEVLS
GIKLPREKGRMRFHRLQNVQIALDFLKQRQVKLVNIRNDDITDGNPKLTLGLIWTIILHF
QISDIYISGESGDMSAKEKLLLWTQKVTAGYTGIKCTNFSSCWSDGKMFNALIHRYRPDL
VDMERVQIQSNRENLEQAFEVAERLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKV
PEGGEGISATEVDSRWQEYQSRVDSLIPWIKQHTILMSDKTFPQNPVELKALYNQYIHFK
ETEILAKEREKGRIEELYKLLEVWIEFGRIKLPQGYHPNDVEEEWGKLIIEMLEREKSLR
PAVERLELLLQIANKIQNGALNCEEKLTLAKNTLQADAAHLESGQPVQCESDVIMYIQEC
EGLIRQLQVDLQILRDENYYQLEELAFRVMRLQDELVTLRLECTNLYRKGHFTSLELVPP
STLTTTHLKAEPLTKATHSSSTSWFRKPMTRAELVAISSSEDEGNLRFVYELLSWVEEMQ
MKLERAEWGNDLPSVELQLETQQHIHTSVEELGSSVKEARLYEGKMSQNFHTSYAETLGK
LETQYCKLKETSSFRMRHLQSLHKFVSRATAELIWLNEKEEEELAYDWSDNNSNISAKRN
YFSELTMELEEKQDVFRSLQDTAELLSLENHPAKQTVEAYSAAVQSQLQWMKQLCLCVEQ
HVKENTAYFQFFSDARELESFLRNLQDSIKRKYSCDHNTSLSRLEDLLQDSMDEKEQLIQ
SKSSVASLVGRSKTIVQLKPRSPDHVLKNTISVKAVCDYRQIEITICKNDECVLEDNSQR
TKWKVISPTGNEAMVPSVCFLIPPPNKDAIEMASRVEQSYQKVMALWHQLHVNTKSLISW
NYLRKDLDLVQTWNLEKLRSSAPGECHQIMKNLQAHYEDFLQDSRDSVLFSVADRLRLEE
EVEACKARFQHLMKSMENEDKEETVAKMYISELKNIRLRLEEYEQRVVKRIQSLASSRTD
RDAWQDNALRIAEQEHTQEDLQQLRSDLDAVSMKCDSFLHQSPSSSSVPTLRSELNLLVE
KMDHVYGLSTVYLNKLKTVDVIVRSIQDAELLVKGYEIKLSQEEVVLADLSALEAHWSTL
RHWLSDVKDKNSVFSVLDEEIAKAKVVAEQMSRLTPERNLDLERYQEKGSQLQERWHRVI
AQLEIRQSELESIQEVLGDYRACHGTLIKWIEETTAQQEMMKPGQAEDSRVLSEQLSQQT
ALFAEIERNQTKLDQCQKFSQQYSTIVKDYELQLMTYKAFVESQQKSPGKRRRMLSSSDA
ITQEFMDLRTRYTALVTLTTQHVKYISDALRRLEEEEKVVEEEKQEHVEKVKELLGWVST
LARNTQGKATSSETKESTDIEKAILEQQVLSEELTTKKEQVSEAIKTSQIFLAKHGHKLS
EKEKKQISEQLNALNKAYHDLCDGSANQLQQLQSQLAHQTEQKTLQKQQNTCHQQLEDLC
SWVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDDIQNRATSFATVVKDIEGFMEEN
QTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELEEAVTSALQQETEKSKAAKELAE
NKKKIDALLDWVTSVGSSGGQLLTNLPGMEQLSGASLEKGALDTTDGYMGVNQAPEKLDK
QCEMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLTPEEQQMLQQKLGELKEQYSTSL
AQSEAELKQVQTLQDELQKFLQDHKEFESWLERSEKELENMHKGGSSPETLPSLLKRQGS
FSEDVISHKGDLRFVTISGQKVLDMENSFKEGKEPSEIGNLVKDKLKDATERYTALHSKC
TRLGSHLNMLLGQYHQFQNSADSLQAWMQACEANVEKLLSDTVASDPGVLQEQLATTKQL
QEELAEHQVPVEKLQKVARDIMEIEGEPAPDHRHVQETTDSILSHFQSLSYSLAERSSLL
QKAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSSGVIQEALATNMKLKQDIARQKS
SLEATREMVTRFMETADSTTAAVLQGKLAEVSQRFEQLCLQQQEKESSLKKLLPQAEMFE
HLSGKLQQFMENKSRMLASGNQPDQDITHFFQQIQELNLEMEDQQENLDTLEHLVTELSS
CGFALDLCQHQDRVQNLRKDFTELQKTVKEREKDASSCQEQLDEFRKLVRTFQKWLKETE
GSIPPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEEINCKGTSLENLIMEITAPDSQG
KTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLKYEKLGGVLHERQESLQAILNRM
EEVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKAQAESNKAFLAELEQNSPKIQKV
KEALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVTVARQRQLEESASHLACFQAAES
QLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLKEFEARRQQHEQLNEAAQGILTG
PGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQAIVKSTQYQELLQDLSEKVRAV
GQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEVKEAQTLCDELSVLIGEQYLKDE
LKKRLETVALPLQGLEDLAADRINRLQAALASTQQFQQMFDELRTWLDDKQSQQAKNCPI
SAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESLLLSVPPGEEKRTLQNQLVELKN
HWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIEDCKAKMSELRVTLDPVQLESSL
LRSKAMLNEVEKRRSLLEILNSAADILINSSEADEDGIRDEKAGINQNMDAVTEELQAKT
GSLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALGSQACSNKNLEKLRAQQEVLQAL
EPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEFLEVKQRVNSGCVMMENKLEGIG
QFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIEDVRLFLNKIHVLKLDIEASEAE
CRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQEQLELTLGRVEDFYRKLKGLND
ATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVDPLQMKLQQVNGLGQGLIQSAGK
DCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLHCGKFQDALEPLLSWLADTEELI
ANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQAEGGRIAQSAELADREKITGQL
ESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPISDFLSVTEKKLANSEPVGTQTA
KIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTSPAEQGVLSEKIDSLQARYSEIQ
DRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKLSSVFVKDFKQDVLHRQHADHLA
LNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKLDGIKTRYADITVTSSKALRTLE
QARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGEQIPQFQQRQKELKKEVMEHRLV
LDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVSDTIGQRVDEIDAAIQRSQQYEQ
AADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKAFSIDIIRHKDSMDELFSHRSEI
FGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLERAQVLVNQFWETYEELSPWIEE
TRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPHIDKLLKIGPQLKELNPEEGEMV
EEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEFHDKIEPMLETLENLSSRLRMPP
LIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGEELIGRSQGADKDLAAKEIQDKL
DQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAALLTTIKDTQDIVHDLESPGIDPS
IIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACGETEKPEVRKSIDEMNNAWENLN
KTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKLCTMPPVGTDLNTVKDQLNEMKE
FKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREPLTELKHLWENLGEKIAHRQHKL
EGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDPKVIEVELAKHHVLKNDVLAHQA
TVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWESVLQKTEEREQQLQSTLQQAQGFH
SEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHMELYSQLKAKEETYNQLLDKGRL
MLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSKLEEALNLATEFQNSLQEFINWL
TLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHRDQIIELDQTGNQLKFLSQKQDV
VLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQFHEAWKKLIDWLEDAESHLDSEL
EISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGRALKEKTLLPEDSQKLDNFLGEV
RDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDWLYKVEPQLAEDQPVHGDLDLVM
NLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDTTWVKGQLQELSTRWDTVCKLSV
SKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRGALPDDTEALQSLIDTHKEFMKK
VEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIRARFEEVLTWAKQHQQRLETALS
ELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRVKALIAEHQTFMEEMTRKQPDVD
RVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPMPILSQSEAKNPRINQLSARWQQ
VWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYMRWMNHKKSRVMDFFRRIDKDQD
GKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGYIDYYEFVAALHPNKDAYRPTTD
ADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQQLRLVRILRSTVMVRVGGGWMAL
DEFLVKNDPCRARGRTNIELREKFILPEGASQGMTPFRSRGRRSKPSSRAASPTRSSSSA
SQSNHSCTSMPSSPATPASGTKVIPSSGSKLKRPTPTFHSSRTSLAGDTSNSSSPASTGA
KTNRADPKKSASRPGSRAGSRAGSRASSRRGSDASDFDLLETQSACSDTSESSAAGGQGN
SRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences gi|33188445|ref|NP_036222.3| NP_036222.3.87134 NP_036222.3.92137 ENSP00000354573 ENSP00000439537 ENSP00000354573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]