SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355535 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355535
Domain Number 1 Region: 482-818
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 5.75e-115
Family Methionine synthase SAM-binding domain 0.0000000595
Further Details:      
 
Domain Number 2 Region: 2-199
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 2.09e-54
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0042
Further Details:      
 
Domain Number 3 Region: 323-475
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.44e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000262
Further Details:      
 
Domain Number 4 Region: 219-308
Classification Level Classification E-value
Superfamily Methionine synthase domain 3.79e-27
Family Methionine synthase domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355535   Gene: ENSG00000116984   Transcript: ENST00000366576
Sequence length 819
Comment pep:putative chromosome:GRCh38:1:236835616:236900418:1 gene:ENSG00000116984 transcript:ENST00000366576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEA
TETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNILTIGTGMEEHNLYAINFIHATKVIKE
TLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKSGMDMGIVNAGNLPVYDDIHKE
LLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKVIQTDEWRNGPVEERLEYALVKGIEKH
IIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVGDLFGAGKMFLPQVIKSARVMKKAVGH
LIPFMEKEREETRVLNGTVEEEDPYQGTIVLATVKGDVHDIGKNIVGVVLGCNNFRVIDL
GVMTPCDKILKAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAIRIPLLIGGATTSKT
HTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLKDEYFEEIMEEYEDIRQDHYESLKE
RRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQVFEDYDLQKLVDYIDWKPFFDVWQLRG
KYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTLISQKKLRARGVVGFWPAQSIQDDIHL
YAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYYCLSDFIAPLHSGIRDYLGLFAVACFG
VEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAYCGSEQLDVADLRRL
RYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTGIRLTESLAMAPASAVSGLYFSNLKSK
YFAVGKISKDQVEDYALRKNISVAEVEKWLGPILGYDTD
Download sequence
Identical sequences B1ANE3
ENSP00000355535 ENSP00000355535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]