SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355536 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355536
Domain Number 1 Region: 928-1264
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.44e-114
Family Methionine synthase SAM-binding domain 0.0000000595
Further Details:      
 
Domain Number 2 Region: 22-414
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 2.09e-109
Family Homocysteine S-methyltransferase 0.000014
Further Details:      
 
Domain Number 3 Region: 371-645
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.44e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00052
Further Details:      
 
Domain Number 4 Region: 769-921
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 2.75e-43
Family Cobalamin (vitamin B12)-binding domain 0.00000262
Further Details:      
 
Domain Number 5 Region: 665-754
Classification Level Classification E-value
Superfamily Methionine synthase domain 6.8e-27
Family Methionine synthase domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355536   Gene: ENSG00000116984   Transcript: ENST00000366577
Sequence length 1265
Comment pep:known chromosome:GRCh38:1:236795310:236903981:1 gene:ENSG00000116984 transcript:ENST00000366577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHA
RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC
SAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQA
KGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQT
GEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET
PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGL
EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG
MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD
FLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNI
LTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY
HAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKV
IQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVG
DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATV
KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM
IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN
LKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQV
FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTL
ISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYY
CLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEE
LHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTG
IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL
GYDTD
Download sequence
Identical sequences Q99707
ENSP00000355535 ENSP00000355536 NP_000245.2.87134 NP_000245.2.92137 ENSP00000355536 gi|169790923|ref|NP_000245.2| 9606.ENSP00000355536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]