SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000355891 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000355891
Domain Number 1 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.45e-22
Family Hairpin loop containing domain 0.032
Further Details:      
 
Domain Number 2 Region: 89-135
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000014
Family Kringle modules 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000355891   Gene: ENSG00000122194   Transcript: ENST00000366924
Sequence length 136
Comment pep:putative chromosome:GRCh38:6:160702238:160711883:1 gene:ENSG00000122194 transcript:ENST00000366924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPR
Download sequence
Identical sequences Q5TEH5
gi|270132876|ref|NP_001161810.1| ENSP00000355891 NP_001161810.1.87134 NP_001161810.1.92137 ENSP00000355891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]