SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000356117 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356117
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily LEM domain 0.00000011
Family LEM domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356117   Gene: ENSG00000186007   Transcript: ENST00000367149
Sequence length 67
Comment pep:known chromosome:GRCh38:1:205381381:205420582:-1 gene:ENSG00000186007 transcript:ENST00000367149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILRGLQEHQAPESHMGLSPKRETTARKTRLSRAGE
KKVSQWA
Download sequence
Identical sequences A0A2J8V735
ENSP00000356117 ENSP00000479306 NP_001185981.1.87134 NP_001185981.1.92137 XP_009237043.1.23681 gi|312261254|ref|NP_001185981.1| ENSP00000356117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]