SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000356120 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356120
Domain Number 1 Region: 1-28
Classification Level Classification E-value
Superfamily LEM domain 0.00000451
Family LEM domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356120   Gene: ENSG00000186007   Transcript: ENST00000367152
Sequence length 140
Comment pep:known chromosome:GRCh38:1:205381378:205420574:-1 gene:ENSG00000186007 transcript:ENST00000367152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILQLNIILQGNIILSTEKSKKLKKWPEASTTKRKA
VDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVL
GIFIIVVFVYLTVENKSLFG
Download sequence
Identical sequences NP_001185980.1.87134 NP_001185980.1.92137 ENSP00000356120 ENSP00000356119 ENSP00000356120 gi|312261250|ref|NP_001185980.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]