SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000356121 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356121
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000314
Family LEM domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356121   Gene: ENSG00000186007   Transcript: ENST00000367153
Sequence length 181
Comment pep:known chromosome:GRCh38:1:205381378:205422054:-1 gene:ENSG00000186007 transcript:ENST00000367153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDG
AQDSDDSEELNIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAAR
APSTRITYGTITKERDYCAEDQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLF
G
Download sequence
Identical sequences Q68G75
ENSP00000356119 ENSP00000356121 ENSP00000356117 NP_001185979.1.87134 NP_001185979.1.92137 ENSP00000356121 gi|312261248|ref|NP_001185979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]