SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356397 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356397
Domain Number 1 Region: 152-207
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000229
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 2 Region: 88-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000144
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 22-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000119
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356397   Gene: ENSG00000116785   Transcript: ENST00000367427
Sequence length 232
Comment pep:known chromosome:GRCh38:1:196774813:196793488:1 gene:ENSG00000116785 transcript:ENST00000367427 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLLLINVILTLWVSCANGQVKPCDFPDIKHGGLFHENMRRPYFPVAVGKYYSYYCDEHFE
TPSGSYWDYIHCTQNGWSPAVPCLRKCYFPYLENGYNQNYGRKFVQGNSTEVACHPGYGL
PKAQTTVTCTEKGWSPTPRCIRVRTCSKSDIEIENGFISESSSIYILNKEIQYKCKPGYA
TADGNSSGSITCLQNGWSAQPICITACIAFRAHAQKSCTCRGRNECLILNFC
Download sequence
Identical sequences Q6NSD3
ENSP00000356397 ENSP00000436258 ENSP00000356397 ENSP00000436258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]