SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000356720 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356720
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily Fibronectin type III 5.12e-30
Family Fibronectin type III 0.00096
Further Details:      
 
Domain Number 2 Region: 120-194
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000128
Family Fibronectin type III 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356720   Gene: ENSG00000016402   Transcript: ENST00000367746
Sequence length 209
Comment pep:known chromosome:GRCh38:6:137008888:137044964:-1 gene:ENSG00000016402 transcript:ENST00000367746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAPGRPALRPLPLPPLLLLLLAAPWGRAVPCVSGGLPKPANITFLSINMKNVLQWTPPE
GLQGVKVTYTVQYFIYGQKKWLNKSECRNINRTYCDLSAETSDYEHQYYAKVKAIWGTKC
SKWAESGRFYPFLETQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVSMQQIYSNLK
YNVSVLNTKSNRTVSLKWNGAYIHVPLCS
Download sequence
Identical sequences Q96SH7
ENSP00000356720 ENSP00000356720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]