SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000356819 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000356819
Domain Number 1 Region: 7-432
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-137
Family ALDH-like 0.000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000356819   Gene: ENSG00000118514   Transcript: ENST00000367845
Sequence length 433
Comment pep:known chromosome:GRCh38:6:134917396:134950115:-1 gene:ENSG00000118514 transcript:ENST00000367845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTNALLMLENFIDGKFLPCSSYIDSYDPSTGEVYCRVPNSGKDEIEAAVKAAREAFPS
WSSRSPQERSRVLNQVADLLEQSLEEFAQAESKDQGKTLALARTMDIPRSVQNFRFFASS
SLHHTSECTQMDHLGCMHYTVRAPVGVAGLISPWNLPLYLLTWKIAPAMAAGNTVIAKPS
ELTSVTAWMLCKLLDKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLDECIPATVRSSFANQVRSYVKRALAEGAQIWC
GEGVDKLSLPARNQAGYFMLPTVITDIKDESCCMTEEIFGPVTCVVPFDSEEEVIERANN
VKYGLAATVWSSNVGRVHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSY
DFFTEIKTITVKH
Download sequence
Identical sequences NP_739577.1.87134 NP_739577.1.92137 gi|25952152|ref|NP_739577.1| ENSP00000356819 ENSP00000356819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]