SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000357278 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000357278
Domain Number 1 Region: 49-120
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00000000000000871
Family Crotonase-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000357278   Gene: ENSG00000093144   Transcript: ENST00000368295
Sequence length 125
Comment pep:known chromosome:GRCh38:6:127288762:127331030:-1 gene:ENSG00000093144 transcript:ENST00000368295 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGI
LTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTP
EANFL
Download sequence
Identical sequences J3KP84
ENSP00000357278 ENSP00000357278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]